CDS

Accession Number TCMCG004C22621
gbkey CDS
Protein Id XP_025699854.1
Location join(39794685..39794796,39795374..39795507,39795621..39795716)
Gene LOC112801377
GeneID 112801377
Organism Arachis hypogaea

Protein

Length 113aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA476953
db_source XM_025844069.2
Definition cytochrome c [Arachis hypogaea]

EGGNOG-MAPPER Annotation

COG_category C
Description Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain
KEGG_TC 3.D.4.6
KEGG_Module M00595        [VIEW IN KEGG]
KEGG_Reaction R10151        [VIEW IN KEGG]
KEGG_rclass RC03151        [VIEW IN KEGG]
RC03152        [VIEW IN KEGG]
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko00002        [VIEW IN KEGG]
KEGG_ko ko:K08738        [VIEW IN KEGG]
EC -
KEGG_Pathway ko00920        [VIEW IN KEGG]
ko01100        [VIEW IN KEGG]
ko01120        [VIEW IN KEGG]
ko01524        [VIEW IN KEGG]
ko02020        [VIEW IN KEGG]
ko04115        [VIEW IN KEGG]
ko04210        [VIEW IN KEGG]
ko04214        [VIEW IN KEGG]
ko04215        [VIEW IN KEGG]
ko04932        [VIEW IN KEGG]
ko05010        [VIEW IN KEGG]
ko05012        [VIEW IN KEGG]
ko05014        [VIEW IN KEGG]
ko05016        [VIEW IN KEGG]
ko05134        [VIEW IN KEGG]
ko05145        [VIEW IN KEGG]
ko05152        [VIEW IN KEGG]
ko05161        [VIEW IN KEGG]
ko05164        [VIEW IN KEGG]
ko05167        [VIEW IN KEGG]
ko05168        [VIEW IN KEGG]
ko05200        [VIEW IN KEGG]
ko05210        [VIEW IN KEGG]
ko05222        [VIEW IN KEGG]
ko05416        [VIEW IN KEGG]
map00920        [VIEW IN KEGG]
map01100        [VIEW IN KEGG]
map01120        [VIEW IN KEGG]
map01524        [VIEW IN KEGG]
map02020        [VIEW IN KEGG]
map04115        [VIEW IN KEGG]
map04210        [VIEW IN KEGG]
map04214        [VIEW IN KEGG]
map04215        [VIEW IN KEGG]
map04932        [VIEW IN KEGG]
map05010        [VIEW IN KEGG]
map05012        [VIEW IN KEGG]
map05014        [VIEW IN KEGG]
map05016        [VIEW IN KEGG]
map05134        [VIEW IN KEGG]
map05145        [VIEW IN KEGG]
map05152        [VIEW IN KEGG]
map05161        [VIEW IN KEGG]
map05164        [VIEW IN KEGG]
map05167        [VIEW IN KEGG]
map05168        [VIEW IN KEGG]
map05200        [VIEW IN KEGG]
map05210        [VIEW IN KEGG]
map05222        [VIEW IN KEGG]
map05416        [VIEW IN KEGG]
GOs GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005739        [VIEW IN EMBL-EBI]
GO:0005740        [VIEW IN EMBL-EBI]
GO:0005758        [VIEW IN EMBL-EBI]
GO:0031967        [VIEW IN EMBL-EBI]
GO:0031970        [VIEW IN EMBL-EBI]
GO:0031974        [VIEW IN EMBL-EBI]
GO:0031975        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043233        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044429        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0070013        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGGCGTCTTTTGACCAGGCACCTCCCGGCGACTCCAAGTCCGGCGAGAAAATCTTCAAGACCAAGTGCGCTCAGTGCCACACCGTCGAGAAAGGTGCCGGCCACAAACAAGGACCCAATCTGAATGGTTTGTTTGGAAGGCAGTCAGGCACTACTACTGGATACTCCTATTCTGCTGCTAACAAGAGCATGGCTGTGACTTGGGAGGAAAAGACCCTATATGATTACTTGCTTAATCCCAAAAAGTATATTCCAGGGACAAAGATGGTGTTTCCAGGTCTTAAGAAACCCCAGGAACGCGCTGATCTTATTGCATATCTGAAAGAATCAACTGCACAGTAA
Protein:  
MASFDQAPPGDSKSGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTTGYSYSAANKSMAVTWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKESTAQ